Lineage for d1gxra_ (1gxr A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 170720Fold b.69: 7-bladed beta-propeller [50964] (10 superfamilies)
  4. 170765Superfamily b.69.4: Trp-Asp repeat (WD-repeat) [50978] (1 family) (S)
  5. 170766Family b.69.4.1: Trp-Asp repeat (WD-repeat) [50979] (4 proteins)
    this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain
  6. 170785Protein Groucho/tle1, C-therminal domain [75009] (1 species)
  7. 170786Species Human (Homo sapiens) [TaxId:9606] [75010] (1 PDB entry)
  8. 170787Domain d1gxra_: 1gxr A: [70722]

Details for d1gxra_

PDB Entry: 1gxr (more details), 1.65 Å

PDB Description: wd40 region of human groucho/tle1

SCOP Domain Sequences for d1gxra_:

Sequence, based on SEQRES records: (download)

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-therminal domain {Human (Homo sapiens)}
dyfqgamgskpaysfhvtadgqmqpvpfppdaligpgiprharqintlnhgevvcavtis
nptrhvytggkgcvkvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeast
lsiwdlaaptprikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfq
ghtdgascidisndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewla
vgmessnvevlhvnkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasi
fqskesssvlscdisvddkyivtgsgdkkatvyeviy

Sequence, based on observed residues (ATOM records): (download)

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-therminal domain {Human (Homo sapiens)}
dyfqgamgskpaysfhvtadgqmqpvpfppdaligpgiprharqintlnhgevvcavtis
nptrhvytggkgcvkvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeast
lsiwdlaaprikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfqgh
tdgascidisndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewlavg
messnvevlhvnkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasifq
skesssvlscdisvddkyivtgsgdkkatvyeviy

SCOP Domain Coordinates for d1gxra_:

Click to download the PDB-style file with coordinates for d1gxra_.
(The format of our PDB-style files is described here.)

Timeline for d1gxra_: