Lineage for d1gxrb_ (1gxr B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2065971Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2065972Family b.69.4.1: WD40-repeat [50979] (13 protein domains)
  6. 2066038Protein Groucho/tle1, C-terminal domain [75009] (1 species)
  7. 2066039Species Human (Homo sapiens) [TaxId:9606] [75010] (4 PDB entries)
  8. 2066041Domain d1gxrb_: 1gxr B: [70723]
    complexed with ca

Details for d1gxrb_

PDB Entry: 1gxr (more details), 1.65 Å

PDB Description: WD40 Region of Human Groucho/TLE1
PDB Compounds: (B:) transducin-like enhancer protein 1

SCOPe Domain Sequences for d1gxrb_:

Sequence, based on SEQRES records: (download)

>d1gxrb_ b.69.4.1 (B:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dyfqgamgskpaysfhvtadgqmqpvpfppdaligpgiprharqintlnhgevvcavtis
nptrhvytggkgcvkvwdishpgnkspvsqldclnrdnyirsckllpdgctlivggeast
lsiwdlaaptprikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfq
ghtdgascidisndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewla
vgmessnvevlhvnkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasi
fqskesssvlscdisvddkyivtgsgdkkatvyeviy

Sequence, based on observed residues (ATOM records): (download)

>d1gxrb_ b.69.4.1 (B:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dyfqgamgskpaysfhvmqpvpfppdaligpgiprharqintlnhgevvcavtisnptrh
vytggkgcvkvwdishkspvsqldclnrdnyirsckllpdgctlivggeastlsiwdlap
rikaeltssapacyalaispdskvcfsccsdgniavwdlhnqtlvrqfqghtdgascidi
sndgtklwtggldntvrswdlregrqlqqhdftsqifslgycptgewlavgmessnvevl
hkpdkyqlhlhescvlslkfaycgkwfvstgkdnllnawrtpygasifqskesssvlscd
isvddkyivtgsgdkkatvyeviy

SCOPe Domain Coordinates for d1gxrb_:

Click to download the PDB-style file with coordinates for d1gxrb_.
(The format of our PDB-style files is described here.)

Timeline for d1gxrb_: