SCOPe 2.07: Domain d1gxpb_: 1gxp B:

Lineage for d1gxpb_ (1gxp B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.1: PhoB-like [46895] (6 proteins)
   contains 4-stranded meander beta-sheet in the N-terminal extension

6. Protein PhoB [46898] (2 species)

7. Species Escherichia coli [TaxId:562] [46899] (4 PDB entries)

8. Domain d1gxpb_: 1gxp B: [70718]
   protein/DNA complex

Details for d1gxpb_

PDB Entry: 1gxp, 2.5 Å

PDB Description: phob effector domain in complex with pho box dna.

PDB Compounds: (B:) phosphate regulon transcriptional regulatory protein

SCOPe Domain Sequences for d1gxpb_:

Sequence; same for both SEQRES and ATOM records:

>d1gxpb_ a.4.6.1 (B:) PhoB {Escherichia coli [TaxId: 562]}
eeviemqglsldptshrvmageeplemgptefkllhffmthpervysreqllnhvwgtnv
yvedrtvdvhirrlrkalepgghdrmvqtvrgtgyrfstrf

Timeline for d1gxpb_:

• d1gxpb_ first appeared in SCOP 1.61
  
• d1gxpb_ appears in SCOPe 2.06
  
• d1gxpb_ appears in the current release, SCOPe 2.08