Lineage for d1gxpb_ (1gxp B:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 149792Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 150473Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (3 families) (S)
  5. 150474Family a.4.6.1: PhoB-like [46895] (2 proteins)
  6. 150479Protein PhoB [46898] (2 species)
  7. 150480Species Escherichia coli [TaxId:562] [46899] (3 PDB entries)
  8. 150483Domain d1gxpb_: 1gxp B: [70718]

Details for d1gxpb_

PDB Entry: 1gxp (more details), 2.5 Å

PDB Description: phob effector domain in complex with pho box dna.

SCOP Domain Sequences for d1gxpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gxpb_ a.4.6.1 (B:) PhoB {Escherichia coli}
eeviemqglsldptshrvmageeplemgptefkllhffmthpervysreqllnhvwgtnv
yvedrtvdvhirrlrkalepgghdrmvqtvrgtgyrfstrf

SCOP Domain Coordinates for d1gxpb_:

Click to download the PDB-style file with coordinates for d1gxpb_.
(The format of our PDB-style files is described here.)

Timeline for d1gxpb_: