Class a: All alpha proteins [46456] (151 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies) |
Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (3 families) |
Family a.4.6.1: PhoB-like [46895] (2 proteins) |
Protein PhoB [46898] (2 species) |
Species Escherichia coli [TaxId:562] [46899] (3 PDB entries) |
Domain d1gxpb_: 1gxp B: [70718] |
PDB Entry: 1gxp (more details), 2.5 Å
SCOP Domain Sequences for d1gxpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gxpb_ a.4.6.1 (B:) PhoB {Escherichia coli} eeviemqglsldptshrvmageeplemgptefkllhffmthpervysreqllnhvwgtnv yvedrtvdvhirrlrkalepgghdrmvqtvrgtgyrfstrf
Timeline for d1gxpb_: