Lineage for d1gxdb1 (1gxd B:2-78)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 909161Fold a.20: PGBD-like [47089] (1 superfamily)
    core: 3 helices; bundle, closed, left-handed twist; parallel
  4. 909162Superfamily a.20.1: PGBD-like [47090] (2 families) (S)
  5. 909171Family a.20.1.2: MMP N-terminal domain [63427] (4 proteins)
  6. 909176Protein Gelatinase A (MMP-2) [63428] (1 species)
  7. 909177Species Human (Homo sapiens) [TaxId:9606] [63430] (3 PDB entries)
  8. 909184Domain d1gxdb1: 1gxd B:2-78 [70697]
    Other proteins in same PDB: d1gxda2, d1gxda3, d1gxda4, d1gxda5, d1gxda6, d1gxdb2, d1gxdb3, d1gxdb4, d1gxdb5, d1gxdb6, d1gxdc_, d1gxdd_
    complexed with ca, so4, zn

Details for d1gxdb1

PDB Entry: 1gxd (more details), 3.1 Å

PDB Description: prommp-2/timp-2 complex
PDB Compounds: (B:) 72 kda type IV collagenase

SCOPe Domain Sequences for d1gxdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gxdb1 a.20.1.2 (B:2-78) Gelatinase A (MMP-2) {Human (Homo sapiens) [TaxId: 9606]}
pspiikfpgdvapktdkelavqylntfygcpkescnlfvlkdtlkkmqkffglpqtgdld
qntietmrkprcgnpdv

SCOPe Domain Coordinates for d1gxdb1:

Click to download the PDB-style file with coordinates for d1gxdb1.
(The format of our PDB-style files is described here.)

Timeline for d1gxdb1: