| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) ![]() |
| Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
| Protein Gelatinase A [55534] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [55535] (4 PDB entries) |
| Domain d1gxdb3: 1gxd B:79-187,B:365-421 [70699] Other proteins in same PDB: d1gxda1, d1gxda2, d1gxda4, d1gxda5, d1gxda6, d1gxdb1, d1gxdb2, d1gxdb4, d1gxdb5, d1gxdb6, d1gxdc_, d1gxdd_ complexed with ca, so4, zn |
PDB Entry: 1gxd (more details), 3.1 Å
SCOPe Domain Sequences for d1gxdb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gxdb3 d.92.1.11 (B:79-187,B:365-421) Gelatinase A {Human (Homo sapiens) [TaxId: 9606]}
anynffprkpkwdknqityriigytpdldpetvddafarafqvwsdvtplrfsrihdgea
diminfgrwehgdgypfdgkdgllahafapgtgvggdshfdddelwtlgXgyslflvaah
afghamglehsqdpgalmapiytytknfrlsqddikgiqelygaspd
Timeline for d1gxdb3: