Lineage for d1gxda3 (1gxd A:79-187,A:365-421)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1211973Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1211974Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1212397Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 1212490Protein Gelatinase A [55534] (1 species)
  7. 1212491Species Human (Homo sapiens) [TaxId:9606] [55535] (4 PDB entries)
  8. 1212498Domain d1gxda3: 1gxd A:79-187,A:365-421 [70693]
    Other proteins in same PDB: d1gxda1, d1gxda2, d1gxda4, d1gxda5, d1gxda6, d1gxdb1, d1gxdb2, d1gxdb4, d1gxdb5, d1gxdb6, d1gxdc_, d1gxdd_
    complexed with ca, so4, zn

Details for d1gxda3

PDB Entry: 1gxd (more details), 3.1 Å

PDB Description: prommp-2/timp-2 complex
PDB Compounds: (A:) 72 kda type IV collagenase

SCOPe Domain Sequences for d1gxda3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gxda3 d.92.1.11 (A:79-187,A:365-421) Gelatinase A {Human (Homo sapiens) [TaxId: 9606]}
anynffprkpkwdknqityriigytpdldpetvddafarafqvwsdvtplrfsrihdgea
diminfgrwehgdgypfdgkdgllahafapgtgvggdshfdddelwtlgXgyslflvaah
afghamglehsqdpgalmapiytytknfrlsqddikgiqelygaspd

SCOPe Domain Coordinates for d1gxda3:

Click to download the PDB-style file with coordinates for d1gxda3.
(The format of our PDB-style files is described here.)

Timeline for d1gxda3: