![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.5: Trp RNA-binding attenuation protein (TRAP) [51219] (1 family) ![]() shorter variant of double-helix |
![]() | Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (1 protein) |
![]() | Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [51223] (4 PDB entries) |
![]() | Domain d1gtnq_: 1gtn Q: [70523] |
PDB Entry: 1gtn (more details), 2.5 Å
SCOP Domain Sequences for d1gtnq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gtnq_ b.82.5.1 (Q:) Trp RNA-binding attenuation protein (TRAP) {Bacillus stearothermophilus} tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq trhgvieseg
Timeline for d1gtnq_: