Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.2: alpha-helical ferredoxin [46548] (2 families) contains two Fe4-S4 clusters |
Family a.1.2.2: Dihydropyrimidine dehydrogenase, N-terminal domain [46553] (1 protein) |
Protein Dihydropyrimidine dehydrogenase, N-terminal domain [46554] (1 species) includes the N-terminal tail and the linker to domain 2 |
Species Pig (Sus scrofa) [TaxId:9823] [46555] (5 PDB entries) |
Domain d1gthd1: 1gth D:2-183 [70498] Other proteins in same PDB: d1gtha2, d1gtha3, d1gtha4, d1gtha5, d1gthb2, d1gthb3, d1gthb4, d1gthb5, d1gthc2, d1gthc3, d1gthc4, d1gthc5, d1gthd2, d1gthd3, d1gthd4, d1gthd5 complexed with fad, fmn, idh, iur, ndp, sf4, ura |
PDB Entry: 1gth (more details), 2.25 Å
SCOPe Domain Sequences for d1gthd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gthd1 a.1.2.2 (D:2-183) Dihydropyrimidine dehydrogenase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} apvlskdvadiesilalnprtqshaalhstlakkldkkhwkrnpdkncfhceklennfdd ikhttlgergalreamrclkcadapcqkscpthldiksfitsisnknyygaakmifsdnp lgltcgmvcptsdlcvggcnlyateegsinigglqqfasevfkamnipqirnpclpsqek mp
Timeline for d1gthd1:
View in 3D Domains from same chain: (mouse over for more information) d1gthd2, d1gthd3, d1gthd4, d1gthd5 |