![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.4: Nucleotide-binding domain [51970] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
![]() | Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) ![]() this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains |
![]() | Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (5 proteins) |
![]() | Protein Dihydropyrimidine dehydrogenase, domain 2 [51977] (1 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [51978] (5 PDB entries) |
![]() | Domain d1gthd4: 1gth D:184-287,D:441-532 [70501] Other proteins in same PDB: d1gtha1, d1gtha2, d1gtha3, d1gtha5, d1gthb1, d1gthb2, d1gthb3, d1gthb5, d1gthc1, d1gthc2, d1gthc3, d1gthc5, d1gthd1, d1gthd2, d1gthd3, d1gthd5 complexed with fad, fmn, idh, iur, ndp, sf4, ura |
PDB Entry: 1gth (more details), 2.25 Å
SCOPe Domain Sequences for d1gthd4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gthd4 c.4.1.1 (D:184-287,D:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} eaysakiallgagpasiscasflarlgysditifekqeyvgglstseipqfrlpydvvnf eielmkdlgvkiicgkslseneitlntlkeegykaafigiglpeXvlrdpkvkealspik fnrwdlpevdpetmqtsepwvfaggdivgmanttvesvndgkqaswyihkyiqaqygasv sakpelplfytpvdlvd
Timeline for d1gthd4:
![]() Domains from same chain: (mouse over for more information) d1gthd1, d1gthd2, d1gthd3, d1gthd5 |