Class b: All beta proteins [48724] (119 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.5: Trp RNA-binding attenuation protein (TRAP) [51219] (1 family) shorter variant of double-helix |
Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (1 protein) |
Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species) |
Species Bacillus stearothermophilus [TaxId:1422] [51223] (4 PDB entries) |
Domain d1gtfv_: 1gtf V: [70481] complexed with trp |
PDB Entry: 1gtf (more details), 1.75 Å
SCOP Domain Sequences for d1gtfv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gtfv_ b.82.5.1 (V:) Trp RNA-binding attenuation protein (TRAP) {Bacillus stearothermophilus} tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq trhgvieseg
Timeline for d1gtfv_: