Lineage for d1gtfv_ (1gtf V:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 234509Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 234742Superfamily b.82.5: Trp RNA-binding attenuation protein (TRAP) [51219] (1 family) (S)
    shorter variant of double-helix
  5. 234743Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (1 protein)
  6. 234744Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species)
  7. 234745Species Bacillus stearothermophilus [TaxId:1422] [51223] (4 PDB entries)
  8. 234767Domain d1gtfv_: 1gtf V: [70481]
    complexed with trp

Details for d1gtfv_

PDB Entry: 1gtf (more details), 1.75 Å

PDB Description: the structure of the trp rna-binding attenuation protein (trap) bound to a 53-nucleotide rna molecule containing gaguu repeats

SCOP Domain Sequences for d1gtfv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtfv_ b.82.5.1 (V:) Trp RNA-binding attenuation protein (TRAP) {Bacillus stearothermophilus}
tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
trhgvieseg

SCOP Domain Coordinates for d1gtfv_:

Click to download the PDB-style file with coordinates for d1gtfv_.
(The format of our PDB-style files is described here.)

Timeline for d1gtfv_: