SCOP 1.61: Domain d1gtfq_: 1gtf Q:

Lineage for d1gtfq_ (1gtf Q:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (6 superfamilies)

4. Superfamily b.82.5: Trp RNA-binding attenuation protein (TRAP) [51219] (1 family)

5. Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (1 protein)

6. Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [51223] (4 PDB entries)

8. Domain d1gtfq_: 1gtf Q: [70476]

Details for d1gtfq_

PDB Entry: 1gtf, 1.75 Å

PDB Description: the structure of the trp rna-binding attenuation protein (trap) bound to a 53-nucleotide rna molecule containing gaguu repeats

SCOP Domain Sequences for d1gtfq_:

Sequence; same for both SEQRES and ATOM records:

>d1gtfq_ b.82.5.1 (Q:) Trp RNA-binding attenuation protein (TRAP) {Bacillus stearothermophilus}
tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
trhgvieseg

Timeline for d1gtfq_:

• d1gtfq_ is new in SCOP 1.61
  
• d1gtfq_ appears in SCOP 1.63
  
• d1gtfq_ appears in the current release, SCOPe 2.08