Lineage for d1gtfn_ (1gtf N:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 171721Fold b.82: Double-stranded beta-helix [51181] (6 superfamilies)
  4. 171927Superfamily b.82.5: Trp RNA-binding attenuation protein (TRAP) [51219] (1 family) (S)
  5. 171928Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (1 protein)
  6. 171929Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species)
  7. 171930Species Bacillus stearothermophilus [TaxId:1422] [51223] (4 PDB entries)
  8. 171944Domain d1gtfn_: 1gtf N: [70473]

Details for d1gtfn_

PDB Entry: 1gtf (more details), 1.75 Å

PDB Description: the structure of the trp rna-binding attenuation protein (trap) bound to a 53-nucleotide rna molecule containing gaguu repeats

SCOP Domain Sequences for d1gtfn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtfn_ b.82.5.1 (N:) Trp RNA-binding attenuation protein (TRAP) {Bacillus stearothermophilus}
tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
trhgvieseg

SCOP Domain Coordinates for d1gtfn_:

Click to download the PDB-style file with coordinates for d1gtfn_.
(The format of our PDB-style files is described here.)

Timeline for d1gtfn_: