Lineage for d1gt92_ (1gt9 2:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2481297Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2481298Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2481757Family c.41.1.2: Serine-carboxyl proteinase, SCP [52764] (2 proteins)
    elaborated with additional structures
  6. 2481758Protein Serine-carboxyl proteinase, SCP [52765] (3 species)
  7. 2481765Species Bacillus novosp. MN-32, kumamolisin [TaxId:198803] [75226] (7 PDB entries)
    Uniprot Q8RR56 ! Uniprot Q8RR56
  8. 2481770Domain d1gt92_: 1gt9 2: [70439]
    complexed with ca, so4

Details for d1gt92_

PDB Entry: 1gt9 (more details), 1.38 Å

PDB Description: high resolution crystal structure of a thermostable serine-carboxyl type proteinase, kumamolisin (kscp)
PDB Compounds: (2:) kumamolysin

SCOPe Domain Sequences for d1gt92_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gt92_ c.41.1.2 (2:) Serine-carboxyl proteinase, SCP {Bacillus novosp. MN-32, kumamolisin [TaxId: 198803]}
aaptaytpldvaqayqfpegldgqgqciaiielgggydetslaqyfaslgvsapqvvsvs
vdgatnqptgdpngpdgeveldievagalapgakiavyfapntdagflnaittavhdpth
kpsivsiswggpedswapasiaamnrafldaaalgvtvlaaagdsgstdgeqdglyhvdf
paaspyvlacggtrlvasagrieretvwndgpdggstgggvsrifplpswqeranvppsa
npgagsgrgvpdvagnadpatgyevvidgettviggtsavaplfaalvarinqklgkpvg
ylnptlyqlppevfhditegnndianrariyqagpgwdpctglgspigirllqallp

SCOPe Domain Coordinates for d1gt92_:

Click to download the PDB-style file with coordinates for d1gt92_.
(The format of our PDB-style files is described here.)

Timeline for d1gt92_: