SCOPe 2.07: Domain d1gt91_: 1gt9 1:

Lineage for d1gt91_ (1gt9 1:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.41: Subtilisin-like [52742] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3

4. Superfamily c.41.1: Subtilisin-like [52743] (3 families)

5. Family c.41.1.2: Serine-carboxyl proteinase, SCP [52764] (2 proteins)
   elaborated with additional structures

6. Protein Serine-carboxyl proteinase, SCP [52765] (3 species)

7. Species Bacillus novosp. MN-32, kumamolisin [TaxId:198803] [75226] (7 PDB entries)
   Uniprot Q8RR56 ! Uniprot Q8RR56

8. Domain d1gt91_: 1gt9 1: [70438]
   complexed with ca, so4

Details for d1gt91_

PDB Entry: 1gt9, 1.38 Å

PDB Description: high resolution crystal structure of a thermostable serine-carboxyl type proteinase, kumamolisin (kscp)

PDB Compounds: (1:) kumamolysin

SCOPe Domain Sequences for d1gt91_:

Sequence; same for both SEQRES and ATOM records:

>d1gt91_ c.41.1.2 (1:) Serine-carboxyl proteinase, SCP {Bacillus novosp. MN-32, kumamolisin [TaxId: 198803]}
aaptaytpldvaqayqfpegldgqgqciaiielgggydetslaqyfaslgvsapqvvsvs
vdgatnqptgdpngpdgeveldievagalapgakiavyfapntdagflnaittavhdpth
kpsivsiswggpedswapasiaamnrafldaaalgvtvlaaagdsgstdgeqdglyhvdf
paaspyvlacggtrlvasagrieretvwndgpdggstgggvsrifplpswqeranvppsa
npgagsgrgvpdvagnadpatgyevvidgettviggtsavaplfaalvarinqklgkpvg
ylnptlyqlppevfhditegnndianrariyqagpgwdpctglgspigirllqallp

Timeline for d1gt91_:

• d1gt91_ first appeared in SCOP 1.61
  
• d1gt91_ appears in SCOPe 2.06
  
• d1gt91_ appears in the current release, SCOPe 2.08