Lineage for d1gqmb_ (1gqm B:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 152429Fold a.39: EF Hand-like [47472] (4 superfamilies)
  4. 152430Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 152453Family a.39.1.2: S100 proteins [47478] (1 protein)
  6. 152454Protein Calcyclin (S100) [47479] (13 species)
  7. 152459Species Human (Homo sapiens), calgranulin C, s100a12 [TaxId:9606] [47488] (2 PDB entries)
  8. 152463Domain d1gqmb_: 1gqm B: [70361]

Details for d1gqmb_

PDB Entry: 1gqm (more details), 2.7 Å

PDB Description: the structure of s100a12 in a hexameric form and its proposed role in receptor signalling

SCOP Domain Sequences for d1gqmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gqmb_ a.39.1.2 (B:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12}
tkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqgl
danqdeqvdfqefislvaialkaahyht

SCOP Domain Coordinates for d1gqmb_:

Click to download the PDB-style file with coordinates for d1gqmb_.
(The format of our PDB-style files is described here.)

Timeline for d1gqmb_: