PDB entry 1gqm

View 1gqm on RCSB PDB site
Description: the structure of s100a12 in a hexameric form and its proposed role in receptor signalling
Deposited on 2001-11-26, released 2002-02-28
The last revision prior to the SCOP 1.61 freeze date was dated 2002-03-07, with a file datestamp of 2002-03-07.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.21869
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1gqma_
  • Chain 'B':
    Domains in SCOP 1.61: d1gqmb_
  • Chain 'C':
    Domains in SCOP 1.61: d1gqmc_
  • Chain 'D':
    Domains in SCOP 1.61: d1gqmd_
  • Chain 'E':
    Domains in SCOP 1.61: d1gqme_
  • Chain 'F':
    Domains in SCOP 1.61: d1gqmf_
  • Chain 'G':
    Domains in SCOP 1.61: d1gqmg_
  • Chain 'H':
    Domains in SCOP 1.61: d1gqmh_
  • Chain 'I':
    Domains in SCOP 1.61: d1gqmi_
  • Chain 'J':
    Domains in SCOP 1.61: d1gqmj_
  • Chain 'K':
    Domains in SCOP 1.61: d1gqmk_
  • Chain 'L':
    Domains in SCOP 1.61: d1gqml_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gqmA (A:)
    tkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqgl
    danqdeqvdfqefislvaialkaahyh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gqmB (B:)
    tkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqgl
    danqdeqvdfqefislvaialkaahyht
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gqmC (C:)
    tkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqgl
    danqdeqvdfqefislvaialkaahyh
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gqmD (D:)
    tkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqgl
    danqdeqvdfqefislvaialkaahyh
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gqmE (E:)
    tkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqgl
    danqdeqvdfqefislvaialkaahyh
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gqmF (F:)
    tkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqgl
    danqdeqvdfqefislvaialkaahyh
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gqmG (G:)
    tkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqgl
    danqdeqvdfqefislvaialkaahyh
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gqmH (H:)
    tkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqgl
    danqdeqvdfqefislvaialkaahyht
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gqmI (I:)
    tkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqgl
    danqdeqvdfqefislvaialkaahyh
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gqmJ (J:)
    tkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqgl
    danqdeqvdfqefislvaialkaahyh
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gqmK (K:)
    tkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqgl
    danqdeqvdfqefislvaialkaahyh
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gqmL (L:)
    tkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavideifqgl
    danqdeqvdfqefislvaialkaahy