Lineage for d1gq8a_ (1gq8 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2422942Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2422943Superfamily b.80.1: Pectin lyase-like [51126] (12 families) (S)
    superhelix turns are made of 3 strands each
  5. 2423046Family b.80.1.5: Pectin methylesterase [51147] (2 proteins)
    automatically mapped to Pfam PF01095
    this is a repeat family; one repeat unit is 1qjv A:170-291 found in domain
  6. 2423047Protein Pectin methylesterase PemA [51148] (2 species)
  7. 2423048Species Carrot (Daucus carota) [TaxId:4039] [75026] (1 PDB entry)
  8. 2423049Domain d1gq8a_: 1gq8 A: [70350]
    complexed with cac

Details for d1gq8a_

PDB Entry: 1gq8 (more details), 1.75 Å

PDB Description: pectin methylesterase from carrot
PDB Compounds: (A:) pectinesterase

SCOPe Domain Sequences for d1gq8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gq8a_ b.80.1.5 (A:) Pectin methylesterase PemA {Carrot (Daucus carota) [TaxId: 4039]}
esstvgpnvvvaadgsgdyktvseavaaapedsktryvirikagvyrenvdvpkkkknim
flgdgrtstiitasknvqdgsttfnsatvaavgagflarditfqntagaakhqavalrvg
sdlsafyrcdilayqdslyvhsnrqffincfiagtvdfifgnaavvlqdcdiharrpgsg
qknmvtaqgrtdpnqntgiviqksrigatsdlqpvqssfptylgrpwkeysrtvvmqssi
tnvinpagwfpwdgnfaldtlyygeyqntgagaatsgrvtwkgfkvitssteaqgftpgs
fiaggswlkattfpfslgl

SCOPe Domain Coordinates for d1gq8a_:

Click to download the PDB-style file with coordinates for d1gq8a_.
(The format of our PDB-style files is described here.)

Timeline for d1gq8a_: