Lineage for d1gmld_ (1gml D:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 240180Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (6 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in all proteins known to contain it
  4. 240287Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) (S)
  5. 240348Family c.8.5.2: Group II chaperonin (CCT, TRIC), apical domain [52034] (1 protein)
  6. 240349Protein Thermosome, A-domain [52035] (2 species)
  7. 240358Species Mouse (Mus musculus) [TaxId:10090] [75137] (2 PDB entries)
  8. 240362Domain d1gmld_: 1gml D: [70276]
    gamma-subuni apical domain
    complexed with gol

Details for d1gmld_

PDB Entry: 1gml (more details), 2.2 Å

PDB Description: crystal structure of the mouse cct gamma apical domain (triclinic)

SCOP Domain Sequences for d1gmld_:

Sequence, based on SEQRES records: (download)

>d1gmld_ c.8.5.2 (D:) Thermosome, A-domain {Mouse (Mus musculus)}
scvlrgvminkdvthprmrryiknprivlldssleykkgesqtdieitreedftrilqme
eeyihqlcediiqlkpdvvitekgisdlaqhylmranvtairrvrktdnnriaracgari
vsrpeelreddvgtgaglleikkigdeyftfitdckdpkactillrg

Sequence, based on observed residues (ATOM records): (download)

>d1gmld_ c.8.5.2 (D:) Thermosome, A-domain {Mouse (Mus musculus)}
scvlrgvminkdvthprmrryiknprivlldssleyklqmeeeyihqlcediiqlkpdvv
itekgisdlaqhylmranvtairrvrktdnnriaracgarivsrpeelreddvgtgagll
eikkigdeyftfitdckdpkactillrg

SCOP Domain Coordinates for d1gmld_:

Click to download the PDB-style file with coordinates for d1gmld_.
(The format of our PDB-style files is described here.)

Timeline for d1gmld_: