SCOPe 2.08: Domain d1gmld_: 1gml D:

Lineage for d1gmld_ (1gml D:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.5: GroEL apical domain-like [52029] (3 families)

5. Family c.8.5.2: Group II chaperonin (CCT, TRIC), apical domain [52034] (1 protein)

6. Protein Thermosome, A-domain [52035] (4 species)

7. Species Mouse (Mus musculus), gamma chain [TaxId:10090] [75137] (2 PDB entries)

8. Domain d1gmld_: 1gml D: [70276]
   apical domain only
   complexed with gol

Details for d1gmld_

PDB Entry: 1gml, 2.2 Å

PDB Description: crystal structure of the mouse cct gamma apical domain (triclinic)

PDB Compounds: (D:) t-complex protein 1 subunit gamma

SCOPe Domain Sequences for d1gmld_:

Sequence, based on SEQRES records:

>d1gmld_ c.8.5.2 (D:) Thermosome, A-domain {Mouse (Mus musculus), gamma chain [TaxId: 10090]}
scvlrgvminkdvthprmrryiknprivlldssleykkgesqtdieitreedftrilqme
eeyihqlcediiqlkpdvvitekgisdlaqhylmranvtairrvrktdnnriaracgari
vsrpeelreddvgtgaglleikkigdeyftfitdckdpkactillrga

Sequence, based on observed residues (ATOM records):

>d1gmld_ c.8.5.2 (D:) Thermosome, A-domain {Mouse (Mus musculus), gamma chain [TaxId: 10090]}
scvlrgvminkdvthprmrryiknprivlldssleyklqmeeeyihqlcediiqlkpdvv
itekgisdlaqhylmranvtairrvrktdnnriaracgarivsrpeelreddvgtgagll
eikkigdeyftfitdckdpkactillrga

Timeline for d1gmld_:

• d1gmld_ first appeared in SCOP 1.61
  
• d1gmld_ appears in SCOPe 2.07