![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
![]() | Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) ![]() this domain is interrupted by the catalytic beta/alpha barrel domain |
![]() | Family b.92.1.3: Hydantoinase (dihydropyrimidinase) [75044] (5 proteins) |
![]() | Protein D-hydantoinase [75045] (4 species) |
![]() | Species Thermus sp. [TaxId:275] [75046] (2 PDB entries) |
![]() | Domain d1gkqc1: 1gkq C:2-54,C:390-459 [70247] Other proteins in same PDB: d1gkqa2, d1gkqb2, d1gkqc2, d1gkqd2 complexed with zn |
PDB Entry: 1gkq (more details), 2.6 Å
SCOPe Domain Sequences for d1gkqc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gkqc1 b.92.1.3 (C:2-54,C:390-459) D-hydantoinase {Thermus sp. [TaxId: 275]} pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpgXadlvvy dpqyrgtisvktqhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrre pmyf
Timeline for d1gkqc1: