Lineage for d1gjqa2 (1gjq A:118-543)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 233551Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 233576Superfamily b.70.2: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51004] (1 family) (S)
  5. 233577Family b.70.2.1: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51005] (1 protein)
  6. 233578Protein C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51006] (3 species)
    the N-terminal domain is cytochrome c-like
  7. 233607Species Pseudomonas aeruginosa [TaxId:287] [51008] (9 PDB entries)
  8. 233610Domain d1gjqa2: 1gjq A:118-543 [70194]
    Other proteins in same PDB: d1gjqa1, d1gjqb1

Details for d1gjqa2

PDB Entry: 1gjq (more details), 2.7 Å

PDB Description: pseudomonas aeruginosa cd1 nitrite reductase reduced cyanide complex

SCOP Domain Sequences for d1gjqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gjqa2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa}
ewgmpemreswkvlvkpedrpkkqlndldlpnlfsvtlrdagqialvdgdskkivkvidt
gyavhisrmsasgryllvigrdaridmidlwakeptkvaeikigiearsvesskfkgyed
rytiagaywppqfaimdgetlepkqivstrgmtvdtqtyhpeprvaaiiashehpefivn
vketgkvllvnykdidnltvtsigaapflhdggwdsshryfmtaannsnkvavidskdrr
lsalvdvgktphpgrganfvhpkygpvwstshlgdgsisligtdpknhpqyawkkvaelq
gqgggslfikthpksshlyvdttfnpdarisqsvavfdlknldakyqvlpiaewadlgeg
akrvvqpeynkrgdevwfsvwngkndssalvvvddktlklkavvkdprlitptgkfnvyn
tqhdvy

SCOP Domain Coordinates for d1gjqa2:

Click to download the PDB-style file with coordinates for d1gjqa2.
(The format of our PDB-style files is described here.)

Timeline for d1gjqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gjqa1