Lineage for d1ellp_ (1ell P:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2497307Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2497308Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)
  6. 2497309Protein Carboxypeptidase A [53189] (4 species)
  7. 2497312Species Cow (Bos taurus) [TaxId:9913] [53190] (34 PDB entries)
  8. 2497349Domain d1ellp_: 1ell P: [70129]
    complexed with cd

Details for d1ellp_

PDB Entry: 1ell (more details), 1.76 Å

PDB Description: cadmium-substituted bovine pancreatic carboxypeptidase a (alfa-form) at ph 7.5 and 0.25 m chloride in monoclinic crystal form.
PDB Compounds: (P:) carboxypeptidase a

SCOPe Domain Sequences for d1ellp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ellp_ c.56.5.1 (P:) Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]}
arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp
aiwidlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafth
sqnrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
dfvkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
mehtv

SCOPe Domain Coordinates for d1ellp_:

Click to download the PDB-style file with coordinates for d1ellp_.
(The format of our PDB-style files is described here.)

Timeline for d1ellp_: