Lineage for d1ellp_ (1ell P:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 182572Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
  4. 182719Superfamily c.56.5: Zn-dependent exopeptidases [53187] (5 families) (S)
  5. 182720Family c.56.5.1: Pancreatic carboxypeptidases [53188] (3 proteins)
  6. 182721Protein Carboxypeptidase A [53189] (4 species)
  7. 182724Species Cow (Bos taurus) [TaxId:9913] [53190] (23 PDB entries)
  8. 182735Domain d1ellp_: 1ell P: [70129]

Details for d1ellp_

PDB Entry: 1ell (more details), 1.76 Å

PDB Description: cadmium-substituted bovine pancreatic carboxypeptidase a (alfa-form) at ph 7.5 and 0.25 m chloride in monoclinic crystal form.

SCOP Domain Sequences for d1ellp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ellp_ c.56.5.1 (P:) Carboxypeptidase A {Cow (Bos taurus)}
arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp
aiwidlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafth
sqnrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
dfvkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
mehtv

SCOP Domain Coordinates for d1ellp_:

Click to download the PDB-style file with coordinates for d1ellp_.
(The format of our PDB-style files is described here.)

Timeline for d1ellp_: