Lineage for d1e6ha_ (1e6h A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2782886Protein alpha-Spectrin, SH3 domain [50058] (1 species)
  7. 2782887Species Chicken (Gallus gallus) [TaxId:9031] [50059] (38 PDB entries)
  8. 2782908Domain d1e6ha_: 1e6h A: [70084]
    mutant

Details for d1e6ha_

PDB Entry: 1e6h (more details), 2.01 Å

PDB Description: a-spectrin sh3 domain a11v, m25i, v44i, v58l mutants
PDB Compounds: (A:) spectrin alpha chain

SCOPe Domain Sequences for d1e6ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6ha_ b.34.2.1 (A:) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]}
detgkelvlvlydyqeksprevtikkgdiltllnstnkdwwkievndrqgfvpaaylkkl
d

SCOPe Domain Coordinates for d1e6ha_:

Click to download the PDB-style file with coordinates for d1e6ha_.
(The format of our PDB-style files is described here.)

Timeline for d1e6ha_: