PDB entry 1e6h

View 1e6h on RCSB PDB site
Description: a-spectrin sh3 domain a11v, m25i, v44i, v58l mutants
Class: sh3-domain
Keywords: sh3-domain, cytoskeleton, calmodulin-binding, actin-binding
Deposited on 2000-08-17, released 2001-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.257
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spectrin alpha chain
    Species: GALLUS GALLUS [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07751 (Start-61)
      • engineered (10)
      • engineered (24)
      • engineered (43)
      • engineered (57)
    Domains in SCOPe 2.07: d1e6ha_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e6hA (A:)
    mdetgkelvlvlydyqeksprevtikkgdiltllnstnkdwwkievndrqgfvpaaylkk
    ld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e6hA (A:)
    detgkelvlvlydyqeksprevtikkgdiltllnstnkdwwkievndrqgfvpaaylkkl
    d