Lineage for d1cixa_ (1cix A:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1061532Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1061763Superfamily g.3.6: omega toxin-like [57059] (5 families) (S)
  5. 1061804Family g.3.6.2: Spider toxins [57072] (25 proteins)
  6. 1061889Protein Tachystatin [75666] (1 species)
  7. 1061890Species Japanese horseshoe crab (Tachypleus tridentatus) [TaxId:6853] [75667] (1 PDB entry)
  8. 1061891Domain d1cixa_: 1cix A: [70066]

Details for d1cixa_

PDB Entry: 1cix (more details)

PDB Description: three-dimensional structure of antimicrobial peptide tachystatin a isolated from horseshoe crab
PDB Compounds: (A:) protein (tachystatin a)

SCOPe Domain Sequences for d1cixa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cixa_ g.3.6.2 (A:) Tachystatin {Japanese horseshoe crab (Tachypleus tridentatus) [TaxId: 6853]}
ysrcqlqgfncvvrsyglptipccrgltcrsyfpgstygrcqry

SCOPe Domain Coordinates for d1cixa_:

Click to download the PDB-style file with coordinates for d1cixa_.
(The format of our PDB-style files is described here.)

Timeline for d1cixa_: