SCOPe 2.08: Domain d1kx2a1: 1kx2 A:1-78

Lineage for d1kx2a1 (1kx2 A:1-78)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Mono-heme c-type cytochrome ScyA [68948] (1 species)

7. Species Shewanella putrefaciens [TaxId:24] [68949] (2 PDB entries)

8. Domain d1kx2a1: 1kx2 A:1-78 [68878]
   Other proteins in same PDB: d1kx2a2
   complexed with hec

Details for d1kx2a1

PDB Entry: 1kx2

PDB Description: minimized average structure of a mono-heme ferrocytochrome c from shewanella putrefaciens

PDB Compounds: (A:) mono-heme c-type cytochrome ScyA

SCOPe Domain Sequences for d1kx2a1:

Sequence; same for both SEQRES and ATOM records:

>d1kx2a1 a.3.1.1 (A:1-78) Mono-heme c-type cytochrome ScyA {Shewanella putrefaciens [TaxId: 24]}
qdaeaiynkactvchsmgvagapkshntadweprlakgvdnlvksvktglnamppggmct
dctdedykaaiefmskak

Timeline for d1kx2a1:

• d1kx2a1 first appeared in SCOP 1.59, called d1kx2a_
  
• d1kx2a1 appears in SCOPe 2.07