| Class a: All alpha proteins [46456] (218 folds) |
| Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold |
Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) ![]() duplication: contains multiple CxxCH motifs |
| Family a.138.1.1: Cytochrome c3-like [48696] (4 proteins) |
| Protein Cytochrome c7 (cytochrome c551.5, PpcA) [48703] (3 species) contains three heme groups; deletion of one of Cyt c3 heme-binding sites |
| Species Desulfuromonas acetoxidans [TaxId:891] [48704] (8 PDB entries) |
| Domain d1kwja_: 1kwj A: [68877] |
PDB Entry: 1kwj (more details)
SCOP Domain Sequences for d1kwja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kwja_ a.138.1.1 (A:) Cytochrome c7 (cytochrome c551.5, PpcA) {Desulfuromonas acetoxidans}
advvtyenaagnvtfdhkahaeklgcdachegtpakiaidkksahkdacktchksnngpt
kcggchik
Timeline for d1kwja_: