PDB entry 1kwj

View 1kwj on RCSB PDB site
Description: solution structure determination of the fully oxidized double mutant k9-10a cytochrome c7 from desulfuromonas acetoxidans, minimized average structure
Deposited on 2002-01-29, released 2002-02-06
The last revision prior to the SCOP 1.69 freeze date was dated 2002-03-13, with a file datestamp of 2002-03-13.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.69: d1kwja_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kwjA (A:)
  advvtyenaagnvtfdhkahaeklgcdachegtpakiaidkksahkdacktchksnngpt
  kcggchik