SCOP 1.59: Domain d1ktzb_: 1ktz B:

Lineage for d1ktzb_ (1ktz B:)

1. Root: SCOP 1.59

2. Class g: Small proteins [56992] (58 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)

4. Superfamily g.7.1: Snake toxin-like [57302] (3 families)

5. Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (4 proteins)

6. Protein TGF-beta type II receptor extracellular domain [69951] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69952] (1 PDB entry)

8. Domain d1ktzb_: 1ktz B: [68868]
   Other proteins in same PDB: d1ktza_

Details for d1ktzb_

PDB Entry: 1ktz, 2.15 Å

PDB Description: Crystal Structure of the Human TGF-beta Type II Receptor Extracellular Domain in Complex with TGF-beta3

SCOP Domain Sequences for d1ktzb_:

Sequence; same for both SEQRES and ATOM records:

>d1ktzb_ g.7.1.3 (B:) TGF-beta type II receptor extracellular domain {Human (Homo sapiens)}
pqlckfcdvrfstcdnqkscmsncsitsicekpqevcvavwrkndenitletvchdpklp
yhdfiledaaspkcimkekkkpgetffmcscssdecndniifseey

Timeline for d1ktzb_:

• d1ktzb_ is new in SCOP 1.59
  
• d1ktzb_ appears in SCOP 1.61
  
• d1ktzb_ appears in the current release, SCOPe 2.08