Lineage for d1ktzb_ (1ktz B:)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 143453Fold g.7: Snake toxin-like [57301] (1 superfamily)
  4. 143454Superfamily g.7.1: Snake toxin-like [57302] (3 families) (S)
  5. 143591Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (4 proteins)
  6. 143603Protein TGF-beta type II receptor extracellular domain [69951] (1 species)
  7. 143604Species Human (Homo sapiens) [TaxId:9606] [69952] (1 PDB entry)
  8. 143605Domain d1ktzb_: 1ktz B: [68868]
    Other proteins in same PDB: d1ktza_

Details for d1ktzb_

PDB Entry: 1ktz (more details), 2.15 Å

PDB Description: Crystal Structure of the Human TGF-beta Type II Receptor Extracellular Domain in Complex with TGF-beta3

SCOP Domain Sequences for d1ktzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktzb_ g.7.1.3 (B:) TGF-beta type II receptor extracellular domain {Human (Homo sapiens)}
pqlckfcdvrfstcdnqkscmsncsitsicekpqevcvavwrkndenitletvchdpklp
yhdfiledaaspkcimkekkkpgetffmcscssdecndniifseey

SCOP Domain Coordinates for d1ktzb_:

Click to download the PDB-style file with coordinates for d1ktzb_.
(The format of our PDB-style files is described here.)

Timeline for d1ktzb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ktza_