Lineage for d1ktzb_ (1ktz B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032122Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 3032123Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 3032361Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 3032401Protein TGF-beta type II receptor extracellular domain [69951] (2 species)
    elaborated with additional structures resulting in a beta-sandwich fold
  7. 3032404Species Human (Homo sapiens) [TaxId:9606] [69952] (9 PDB entries)
  8. 3032408Domain d1ktzb_: 1ktz B: [68868]
    Other proteins in same PDB: d1ktza_
    complex with tgf-beta3

Details for d1ktzb_

PDB Entry: 1ktz (more details), 2.15 Å

PDB Description: Crystal Structure of the Human TGF-beta Type II Receptor Extracellular Domain in Complex with TGF-beta3
PDB Compounds: (B:) TGF-beta Type II Receptor

SCOPe Domain Sequences for d1ktzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktzb_ g.7.1.3 (B:) TGF-beta type II receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
pqlckfcdvrfstcdnqkscmsncsitsicekpqevcvavwrkndenitletvchdpklp
yhdfiledaaspkcimkekkkpgetffmcscssdecndniifseey

SCOPe Domain Coordinates for d1ktzb_:

Click to download the PDB-style file with coordinates for d1ktzb_.
(The format of our PDB-style files is described here.)

Timeline for d1ktzb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ktza_