SCOP 1.73: Domain d1kqsv_: 1kqs V:

Lineage for d1kqsv_ (1kqs V:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
   core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold

4. Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family)

5. Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)

6. Protein Archaeal L30 (L30a) [55133] (1 species)
   long-chain member of the family; contains additional C-terminal (sub)domain

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [55134] (40 PDB entries)

8. Domain d1kqsv_: 1kqs V: [68837]
   Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_
   complexed with aca, btn, cd, cl, k, mg, na, pha, ppu

Details for d1kqsv_

PDB Entry: 1kqs, 3.1 Å

PDB Description: The Haloarcula marismortui 50S Complexed with a Pretranslocational Intermediate in Protein Synthesis

PDB Compounds: (V:) ribosomal protein l30

SCOP Domain Sequences for d1kqsv_:

Sequence; same for both SEQRES and ATOM records:

>d1kqsv_ d.59.1.1 (V:) Archaeal L30 (L30a) {Archaeon Haloarcula marismortui [TaxId: 2238]}
mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
prgghdgvkhpvkeggqlgkhdtegiddlleamr

Timeline for d1kqsv_:

• d1kqsv_ first appeared in SCOP 1.59
  
• d1kqsv_ appears in SCOP 1.71
  
• d1kqsv_ appears in SCOP 1.75
  
• d1kqsv_ appears in the current release, SCOPe 2.08