Lineage for d1kqsm_ (1kqs M:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 702503Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 702504Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 702505Protein Ribosomal protein L18 (L18p) [53139] (3 species)
  7. 702506Species Archaeon Haloarcula marismortui [TaxId:2238] [53140] (40 PDB entries)
  8. 702514Domain d1kqsm_: 1kqs M: [68828]
    Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_
    complexed with aca, btn, cd, cl, k, mg, na, pha, ppu

Details for d1kqsm_

PDB Entry: 1kqs (more details), 3.1 Å

PDB Description: The Haloarcula marismortui 50S Complexed with a Pretranslocational Intermediate in Protein Synthesis
PDB Compounds: (M:) ribosomal protein l18

SCOP Domain Sequences for d1kqsm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqsm_ c.55.4.1 (M:) Ribosomal protein L18 (L18p) {Archaeon Haloarcula marismortui [TaxId: 2238]}
atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
dgdiel

SCOP Domain Coordinates for d1kqsm_:

Click to download the PDB-style file with coordinates for d1kqsm_.
(The format of our PDB-style files is described here.)

Timeline for d1kqsm_: