Lineage for d1kqs2_ (1kqs 2:)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750692Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 751110Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (6 families) (S)
  5. 751197Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein)
  6. 751198Protein Ribosomal protein L44e [57837] (1 species)
  7. 751199Species Archaeon Haloarcula marismortui [TaxId:2238] [57838] (40 PDB entries)
  8. 751207Domain d1kqs2_: 1kqs 2: [68813]
    Other proteins in same PDB: d1kqs1_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_
    complexed with aca, btn, cd, cl, k, mg, na, pha, ppu

Details for d1kqs2_

PDB Entry: 1kqs (more details), 3.1 Å

PDB Description: The Haloarcula marismortui 50S Complexed with a Pretranslocational Intermediate in Protein Synthesis
PDB Compounds: (2:) ribosomal protein l44e

SCOP Domain Sequences for d1kqs2_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqs2_ g.41.8.3 (2:) Ribosomal protein L44e {Archaeon Haloarcula marismortui [TaxId: 2238]}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe

SCOP Domain Coordinates for d1kqs2_:

Click to download the PDB-style file with coordinates for d1kqs2_.
(The format of our PDB-style files is described here.)

Timeline for d1kqs2_: