SCOPe 2.02: Domain d1kqst_: 1kqs T:

Lineage for d1kqst_ (1kqs T:)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein)

6. Protein Ribosomal protein L24e [57750] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [57751] (44 PDB entries)
   Uniprot P14116

8. Domain d1kqst_: 1kqs T: [68835]
   Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_
   protein/RNA complex; complexed with aca, btn, cd, cl, k, mg, na, pha, ppu

Details for d1kqst_

PDB Entry: 1kqs, 3.1 Å

PDB Description: The Haloarcula marismortui 50S Complexed with a Pretranslocational Intermediate in Protein Synthesis

PDB Compounds: (T:) ribosomal protein l24e

SCOPe Domain Sequences for d1kqst_:

Sequence; same for both SEQRES and ATOM records:

>d1kqst_ g.39.1.6 (T:) Ribosomal protein L24e {Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

Timeline for d1kqst_:

• d1kqst_ first appeared in SCOP 1.59
  
• d1kqst_ appears in SCOPe 2.01
  
• d1kqst_ appears in SCOPe 2.03
  
• d1kqst_ appears in the current release, SCOPe 2.08