Lineage for d1kqse1 (1kqs E:1-79)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1219397Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 1219398Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
  5. 1219399Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 1219400Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 1219472Species Haloarcula marismortui [TaxId:2238] [56057] (40 PDB entries)
    Uniprot P14135
  8. 1219521Domain d1kqse1: 1kqs E:1-79 [68819]
    Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_
    protein/RNA complex; complexed with aca, btn, cd, cl, k, mg, na, pha, ppu

Details for d1kqse1

PDB Entry: 1kqs (more details), 3.1 Å

PDB Description: The Haloarcula marismortui 50S Complexed with a Pretranslocational Intermediate in Protein Synthesis
PDB Compounds: (E:) ribosomal protein l6

SCOPe Domain Sequences for d1kqse1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqse1 d.141.1.1 (E:1-79) Ribosomal protein L6 {Haloarcula marismortui [TaxId: 2238]}
prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
tigtfqshienmfhgvteg

SCOPe Domain Coordinates for d1kqse1:

Click to download the PDB-style file with coordinates for d1kqse1.
(The format of our PDB-style files is described here.)

Timeline for d1kqse1: