Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds) |
Fold e.22: Dehydroquinate synthase-like [56795] (1 superfamily) 2 domains: (1) alpha/beta of a Rossmann-fold topology, binds NAD (2) multihelical array |
Superfamily e.22.1: Dehydroquinate synthase-like [56796] (2 families) |
Family e.22.1.2: Glycerol dehydrogenase-like [69892] (2 proteins) |
Protein Glycerol dehydrogenase [69893] (2 species) |
Species Thermotoga maritima, TM0423 [69895] (1 PDB entry) TM0423 |
Domain d1kq3a_: 1kq3 A: [68790] structural genomics protein; complexed with cl, trs, zn |
PDB Entry: 1kq3 (more details), 1.5 Å
SCOP Domain Sequences for d1kq3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kq3a_ e.22.1.2 (A:) Glycerol dehydrogenase {Thermotoga maritima, TM0423} hmitttifpgryvqgagainileeelsrfgerafvviddfvdknvlgenffssftkvrvn kqifggecsdeeierlsglveeetdvvvgigggktldtakavayklkkpvvivptiastd apcsalsviytpngefkrylflprnpdvvlvdteivakaparflvagmgdalatwfeaes ckqkyapnmtgrlgsmtayalarlcyetlleygvlakrsveeksvtpalekiveantlls glgfesgglaaahaihngltvlenthkylhgekvaigvlaslfltdkprkmieevysfce evglpttlaeigldgvsdedlmkvaekacdknetihnepqpvtskdvffalkaadrygrm rknl
Timeline for d1kq3a_: