Lineage for d1kq3a_ (1kq3 A:)

  1. Root: SCOP 1.61
  2. 199953Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 201176Fold e.22: Dehydroquinate synthase-like [56795] (1 superfamily)
  4. 201177Superfamily e.22.1: Dehydroquinate synthase-like [56796] (2 families) (S)
  5. 201183Family e.22.1.2: Glycerol dehydrogenase-like [69892] (2 proteins)
  6. 201188Protein Glycerol dehydrogenase [69893] (2 species)
  7. 201193Species Thermotoga maritima, TM0423 [69895] (1 PDB entry)
  8. 201194Domain d1kq3a_: 1kq3 A: [68790]

Details for d1kq3a_

PDB Entry: 1kq3 (more details), 1.5 Å

PDB Description: crystal structure of a glycerol dehydrogenase (tm0423) from thermotoga maritima at 1.5 a resolution

SCOP Domain Sequences for d1kq3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kq3a_ e.22.1.2 (A:) Glycerol dehydrogenase {Thermotoga maritima, TM0423}
hmitttifpgryvqgagainileeelsrfgerafvviddfvdknvlgenffssftkvrvn
kqifggecsdeeierlsglveeetdvvvgigggktldtakavayklkkpvvivptiastd
apcsalsviytpngefkrylflprnpdvvlvdteivakaparflvagmgdalatwfeaes
ckqkyapnmtgrlgsmtayalarlcyetlleygvlakrsveeksvtpalekiveantlls
glgfesgglaaahaihngltvlenthkylhgekvaigvlaslfltdkprkmieevysfce
evglpttlaeigldgvsdedlmkvaekacdknetihnepqpvtskdvffalkaadrygrm
rknl

SCOP Domain Coordinates for d1kq3a_:

Click to download the PDB-style file with coordinates for d1kq3a_.
(The format of our PDB-style files is described here.)

Timeline for d1kq3a_: