![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.12: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69099] (1 family) ![]() automatically mapped to Pfam PF07834 |
![]() | Family a.118.12.1: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69100] (2 proteins) |
![]() | Protein Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69101] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [69102] (1 PDB entry) |
![]() | Domain d1kpsd_: 1kps D: [68789] Other proteins in same PDB: d1kpsa1, d1kpsa2, d1kpsc_ complexed with so4 |
PDB Entry: 1kps (more details), 2.5 Å
SCOPe Domain Sequences for d1kpsd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kpsd_ a.118.12.1 (D:) Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} dlstflsfpspekllrlgpkvsvlivqqtdtsdpekvvsaflkvasvfrddasvktavld aidalmkkafscssfnsntfltrllihmgllksedkikaipslhgplmvlnhvvrqdyfp kalaplllafvtkpngaletcsfarhnllqtlyni
Timeline for d1kpsd_:
![]() Domains from other chains: (mouse over for more information) d1kpsa1, d1kpsa2, d1kpsb_, d1kpsc_ |