Lineage for d1kooc1 (1koo C:201-362)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119773Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies)
  4. 119809Superfamily c.10.2: L domain-like [52058] (6 families) (S)
  5. 119823Family c.10.2.3: mRNA export factor tap [52065] (1 protein)
    this is a repeat family; one repeat unit is 1fo1 A:248-278 found in domain
  6. 119824Protein mRNA export factor tap [52066] (1 species)
  7. 119825Species Human (Homo sapiens) [TaxId:9606] [52067] (4 PDB entries)
  8. 119832Domain d1kooc1: 1koo C:201-362 [68729]
    Other proteins in same PDB: d1kooa2, d1kooc2

Details for d1kooc1

PDB Entry: 1koo (more details), 3.8 Å

PDB Description: the crystal structure and mutational analysis of a novel rna-binding domain found in the human tap nuclear mrna export factor

SCOP Domain Sequences for d1kooc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kooc1 c.10.2.3 (C:201-362) mRNA export factor tap {Human (Homo sapiens)}
lnelkpeqveqlklimskrydgsqqaldlkglrsdpdlvaqnidvvlnrrssmaatlrii
eenipellslnlsnnrlyrlddmssivqkapnlkilnlsgnelksereldkikglkleel
wldgnslcdtfrdqstyisairerfpkllrldghelpppiaf

SCOP Domain Coordinates for d1kooc1:

Click to download the PDB-style file with coordinates for d1kooc1.
(The format of our PDB-style files is described here.)

Timeline for d1kooc1: