Lineage for d1kooc2 (1koo C:101-200)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 133319Fold d.58: Ferredoxin-like [54861] (39 superfamilies)
  4. 133613Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) (S)
  5. 133712Family d.58.7.2: Non-canonical RBD domain [54954] (1 protein)
  6. 133713Protein mRNA export factor tap [54955] (1 species)
  7. 133714Species Human (Homo sapiens) [TaxId:9606] [54956] (4 PDB entries)
  8. 133718Domain d1kooc2: 1koo C:101-200 [68730]
    Other proteins in same PDB: d1kooa1, d1koob1, d1kooc1, d1kood1

Details for d1kooc2

PDB Entry: 1koo (more details), 3.8 Å

PDB Description: the crystal structure and mutational analysis of a novel rna-binding domain found in the human tap nuclear mrna export factor

SCOP Domain Sequences for d1kooc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kooc2 d.58.7.2 (C:101-200) mRNA export factor tap {Human (Homo sapiens)}
apperggagtsqdgtsknwfkitipygrkydkawllsmiqskcsvpftpiefhyentraq
ffvedastasalkavnykildrenrrisiiinssapphti

SCOP Domain Coordinates for d1kooc2:

Click to download the PDB-style file with coordinates for d1kooc2.
(The format of our PDB-style files is described here.)

Timeline for d1kooc2: