Lineage for d1ko9a2 (1ko9 A:12-135)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.129: TBP-like [55944] (4 superfamilies) 
Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) 
Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (2 proteins) 
Protein 8-oxoguanine glycosylase [55955] (1 species) Species Human (Homo sapiens) [TaxId:9606] [55956] (3 PDB entries) 
Domain d1ko9a2: 1ko9 A:12-135 [68718]
Other proteins in same PDB: d1ko9a1
Details for d1ko9a2
PDB Entry: 1ko9 (more details), 2.15 Å
PDB Description: Native Structure of the Human 8-oxoguanine DNA Glycosylase hOGG1
SCOP Domain Sequences for d1ko9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ko9a2 d.129.1.2 (A:12-135) 8-oxoguanine glycosylase {Human (Homo sapiens)}
ghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltqtee
qlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr
llrq
SCOP Domain Coordinates for d1ko9a2:
Click to download the PDB-style file with coordinates for d1ko9a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ko9a2:
- d1ko9a2 is new in SCOP 1.59
- d1ko9a2 appears in SCOP 1.61
- d1ko9a2 appears in the current release, SCOPe 2.08
View in 3D
