Lineage for d1ko9a1 (1ko9 A:136-323)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) 
Fold a.96: DNA-glycosylase [48149] (1 superfamily) Superfamily a.96.1: DNA-glycosylase [48150] (3 families) 
Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (2 proteins) 
Protein 8-oxoguanine glycosylase [48160] (1 species) Species Human (Homo sapiens) [TaxId:9606] [48161] (3 PDB entries) 
Domain d1ko9a1: 1ko9 A:136-323 [68717]
Other proteins in same PDB: d1ko9a2
Details for d1ko9a1
PDB Entry: 1ko9 (more details), 2.15 Å
PDB Description: Native Structure of the Human 8-oxoguanine DNA Glycosylase hOGG1
SCOP Domain Sequences for d1ko9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ko9a1 a.96.1.3 (A:136-323) 8-oxoguanine glycosylase {Human (Homo sapiens)}
dpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqalagpeveah
lrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtkvadcic
lmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpyagwaq
avlfsadl
SCOP Domain Coordinates for d1ko9a1:
Click to download the PDB-style file with coordinates for d1ko9a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ko9a1:
- d1ko9a1 is new in SCOP 1.59
- d1ko9a1 appears in SCOP 1.61
- d1ko9a1 appears in the current release, SCOPe 2.08
View in 3D
