SCOP 1.63: Domain d1ko9a1: 1ko9 A:136-323

Lineage for d1ko9a1 (1ko9 A:136-323)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (4 families)

5. Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (2 proteins)

6. Protein 8-oxoguanine glycosylase [48160] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48161] (7 PDB entries)

8. Domain d1ko9a1: 1ko9 A:136-323 [68717]
   Other proteins in same PDB: d1ko9a2
   complexed with so4

Details for d1ko9a1

PDB Entry: 1ko9, 2.15 Å

PDB Description: Native Structure of the Human 8-oxoguanine DNA Glycosylase hOGG1

SCOP Domain Sequences for d1ko9a1:

Sequence; same for both SEQRES and ATOM records:

>d1ko9a1 a.96.1.3 (A:136-323) 8-oxoguanine glycosylase {Human (Homo sapiens)}
dpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqalagpeveah
lrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtkvadcic
lmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpyagwaq
avlfsadl

Timeline for d1ko9a1:

• d1ko9a1 first appeared in SCOP 1.59
  
• d1ko9a1 appears in SCOP 1.61
  
• d1ko9a1 appears in SCOP 1.65
  
• d1ko9a1 appears in the current release, SCOPe 2.08