SCOPe 2.01: Domain d1kkrb2: 1kkr B:1-160

Lineage for d1kkrb2 (1kkr B:1-160)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein beta-Methylaspartase [69714] (2 species)

7. Species Citrobacter amalonaticus [TaxId:35703] [69716] (2 PDB entries)

8. Domain d1kkrb2: 1kkr B:1-160 [68686]
   Other proteins in same PDB: d1kkra1, d1kkrb1
   complexed with 2as, mg

Details for d1kkrb2

PDB Entry: 1kkr, 2.1 Å

PDB Description: crystal structure of citrobacter amalonaticus methylaspartate ammonia lyase containing (2s,3s)-3-methylaspartic acid

PDB Compounds: (B:) 3-methylaspartate ammonia-lyase

SCOPe Domain Sequences for d1kkrb2:

Sequence; same for both SEQRES and ATOM records:

>d1kkrb2 d.54.1.1 (B:1-160) beta-Methylaspartase {Citrobacter amalonaticus [TaxId: 35703]}
mkikqalftagyssfyfddqqaikngaghdgfiytgdpvtpgftsvrqagecvsvqlile
ngavavgdcaavqysgaggrdplflaehfipflndhikpllegrdvdaflpnarffdklr
idgnllhtavryglsqalldatalasgrlktevvcdewql

Timeline for d1kkrb2:

• d1kkrb2 first appeared in SCOP 1.59
  
• d1kkrb2 appears in SCOP 1.75
  
• d1kkrb2 appears in SCOPe 2.02
  
• d1kkrb2 appears in the current release, SCOPe 2.08