Lineage for d1kkrb2 (1kkr B:1-160)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 860453Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 860454Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 860455Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 860456Protein beta-Methylaspartase [69714] (2 species)
  7. 860457Species Citrobacter amalonaticus [TaxId:35703] [69716] (2 PDB entries)
  8. 860461Domain d1kkrb2: 1kkr B:1-160 [68686]
    Other proteins in same PDB: d1kkra1, d1kkrb1
    complexed with 3md, mg

Details for d1kkrb2

PDB Entry: 1kkr (more details), 2.1 Å

PDB Description: crystal structure of citrobacter amalonaticus methylaspartate ammonia lyase containing (2s,3s)-3-methylaspartic acid
PDB Compounds: (B:) 3-methylaspartate ammonia-lyase

SCOP Domain Sequences for d1kkrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kkrb2 d.54.1.1 (B:1-160) beta-Methylaspartase {Citrobacter amalonaticus [TaxId: 35703]}
mkikqalftagyssfyfddqqaikngaghdgfiytgdpvtpgftsvrqagecvsvqlile
ngavavgdcaavqysgaggrdplflaehfipflndhikpllegrdvdaflpnarffdklr
idgnllhtavryglsqalldatalasgrlktevvcdewql

SCOP Domain Coordinates for d1kkrb2:

Click to download the PDB-style file with coordinates for d1kkrb2.
(The format of our PDB-style files is described here.)

Timeline for d1kkrb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kkrb1