Lineage for d1kkcb2 (1kkc B:98-213)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191397Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
  4. 191398Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 191399Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 191475Protein Mn superoxide dismutase (MnSOD) [54721] (6 species)
  7. 191479Species Aspergillus fumigatus [TaxId:5085] [69693] (1 PDB entry)
  8. 191481Domain d1kkcb2: 1kkc B:98-213 [68663]
    Other proteins in same PDB: d1kkca1, d1kkcb1, d1kkcx1, d1kkcy1

Details for d1kkcb2

PDB Entry: 1kkc (more details), 2 Å

PDB Description: Crystal structure of Aspergillus fumigatus MnSOD

SCOP Domain Sequences for d1kkcb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kkcb2 d.44.1.1 (B:98-213) Mn superoxide dismutase (MnSOD) {Aspergillus fumigatus}
eksgggkidqapvlkaaieqrwgsfdkfkdafnttllgiqgsgwgwlvtdgpkgklditt
thdqdpvtgaapvfgvdmwehayylqylndkasyakgiwnvinwaeaenryiagdk

SCOP Domain Coordinates for d1kkcb2:

Click to download the PDB-style file with coordinates for d1kkcb2.
(The format of our PDB-style files is described here.)

Timeline for d1kkcb2: