Lineage for d1kkcy1 (1kkc Y:14-97)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 149219Fold a.2: Long alpha-hairpin [46556] (11 superfamilies)
  4. 149315Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 149316Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 149392Protein Mn superoxide dismutase (MnSOD) [46618] (6 species)
  7. 149396Species Aspergillus fumigatus [TaxId:5085] [68944] (1 PDB entry)
  8. 149400Domain d1kkcy1: 1kkc Y:14-97 [68666]
    Other proteins in same PDB: d1kkca2, d1kkcb2, d1kkcx2, d1kkcy2

Details for d1kkcy1

PDB Entry: 1kkc (more details), 2 Å

PDB Description: Crystal structure of Aspergillus fumigatus MnSOD

SCOP Domain Sequences for d1kkcy1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kkcy1 a.2.11.1 (Y:14-97) Mn superoxide dismutase (MnSOD) {Aspergillus fumigatus}
qqytlpplpypydalqpyisqqimelhhkkhhqtyvnglnaaleaqkkaaeatdvpklvs
vqqaikfnggghinhslfwknlap

SCOP Domain Coordinates for d1kkcy1:

Click to download the PDB-style file with coordinates for d1kkcy1.
(The format of our PDB-style files is described here.)

Timeline for d1kkcy1: