Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
Family a.4.6.1: PhoB-like [46895] (6 proteins) contains 4-stranded meander beta-sheet in the N-terminal extension |
Protein PhoB [46898] (2 species) |
Species Thermotoga maritima [TaxId:2336] [68972] (1 PDB entry) |
Domain d1kgsa1: 1kgs A:124-225 [68596] Other proteins in same PDB: d1kgsa2 complexed with scn |
PDB Entry: 1kgs (more details), 1.5 Å
SCOPe Domain Sequences for d1kgsa1:
Sequence, based on SEQRES records: (download)
>d1kgsa1 a.4.6.1 (A:124-225) PhoB {Thermotoga maritima [TaxId: 2336]} skstklvcgdlildtatkkayrgskeidltkkeyqileylvmnknrvvtkeelqehlwsf ddevfsdvlrshiknlrkkvdkgfkkkiihtvrgigyvarde
>d1kgsa1 a.4.6.1 (A:124-225) PhoB {Thermotoga maritima [TaxId: 2336]} skstklvcgdlildtatkkayrgskeidltkkeyqileylvmnknrvvtkeelqehlwvf sdvlrshiknlrkkvdkgfkkkiihtvrgigyvarde
Timeline for d1kgsa1: